This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01846 | CP-EPS8-NLS | GRKKRRQRRRPQSKRKKNKKGKRK | 24 | Derived from the NLS of EPS8 |
| DCTPep02004 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | 42 | Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima) |
| DCTPep02537 | Cilengitide, EMD 121974 | RGDfX | 5 | RGD Fibronectin |
| DCTPep02538 | ATN-161 | PHSCN | 5 | Fibronectin |
| DCTPep03025 | Puma-BH3 | EQWAREIGAQLRRMADDLNA | 20 | Synthetic |
| DCTPep03026 | XXA1-BH3 | RPEIWYAQGLKRFGDEFNAYYAR | 23 | Synthetic |
| DCTPep03027 | XXA4-BH3 | RPEIWYAQWLKRFGDQFNAYYAR | 23 | Synthetic |
| DCTPep03028 | XXA1_Y2dI-BH3 | RPEIWIAQGLKRFGDEFNAYYAR | 23 | Synthetic |
| DCTPep03029 | XXA1_G2gE-BH3 | RPEIWYAQELKRFGDEFNAYYAR | 23 | Synthetic |
| DCTPep03030 | XXA1_K3bR-BH3 | RPEIWYAQGLRRFGDEFNAYYAR | 23 | Synthetic |
| DCTPep03031 | XXA1_F3dI-BH3 | RPEIWYAQGLKRIGDEFNAYYAR | 23 | Synthetic |
| DCTPep03032 | XXA1_Y4eK-BH3 | RPEIWYAQGLKRFGDEFNAYKAR | 23 | Synthetic |
| DCTPep03033 | Y4eK_18-BH3 | IWYAQGLKRFGDEFNAYK | 18 | Synthetic |
| DCTPep03034 | Y4eK_21-BH3 | RPEIWYAQGLKRFGDEFNAYK | 21 | Synthetic |
| DCTPep03035 | BimEL-I146Y | LRPEIRYAQELRRIGDEFNE | 20 | Synthetic |
| DCTPep03036 | Bim-WAA | LWAAIRIAQELRRIGDEFNE | 20 | Synthetic |
| DCTPep03037 | BimEL-Q148R | LRPEIRIARELRRIGDEFNE | 20 | Synthetic |
| DCTPep03038 | BimEL-I153M | LRPEIRIAQELRRMGDEFNE | 20 | Synthetic |
| DCTPep03039 | BimEL-I146Y-Q148R | LRPEIRYARELRRIGDEFNE | 20 | Synthetic |
| DCTPep03040 | BimEL I146Y-I153M | LRPEIRYAQELRRMGDEFNE | 20 | Synthetic |
| DCTPep03041 | BimEL-CTS | PQMVILQLLRFIFRLVWRRH | 20 | Synthetic |
| DCTPep03042 | BimEL-I181E | PQMVELQLLRFIFRLVWRRH | 20 | Synthetic |
| DCTPep03043 | BimEL-L185E | PQMVILQLERFIFRLVWRRH | 20 | Synthetic |
| DCTPep03044 | BimEL-I188E | PQMVILQLLRFEFRLVWRRH | 20 | Synthetic |
| DCTPep03045 | BimEL-V192E | PQMVILQLLRFIFRLEWRRH | 20 | Synthetic |
| DCTPep03046 | BimEL-CST-2A (R186A-R190A) | PQMVILQLLAFIFALVWRRH | 20 | Synthetic |
| DCTPep03047 | Bim SM-1 | IWIAQELRRIGDEFNA | 16 | Synthetic |
| DCTPep03048 | Bim SM-2 | IWIAQELRRIGDEF | 14 | Synthetic |
| DCTPep03049 | Bim SM-3 | IAQELRRIGDEFNA | 14 | Synthetic |
| DCTPep03050 | Bim SM-4 | WIAQELRRIGDEFN | 14 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.