This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00723 | BLP-7 | GIGGALLSAGKSALKGLAKGLAEHFAN | 27 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00724 | Bombinin H-BO | IIGPVLGLIGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00726 | Tachyplesin [C3,7,12,16Del] | KWFRVYRGIYRRR | 13 | Synthetic |
| DCTPep00728 | Reverse Tachyplesin [C3,7,12,16Del] | RRRYIGRYVRFWK | 13 | Synthetic |
| DCTPep00729 | I-3 | LVKRFKKFFRKLKKSVLL | 18 | cationic host defense peptides |
| DCTPep00730 | I-7 | LVRRFRRFFRRLRRSVLL | 18 | cationic host defense peptides |
| DCTPep00731 | I-8 | VKRFKKFFLKLKSV | 14 | cationic host defense peptides |
| DCTPep00733 | I-1 | VKRFKKFFRKLKKSVL | 16 | cationic host defense peptides |
| DCTPep00734 | I-2 | VKRFKKFFRKLKKSVLL | 17 | cationic host defense peptides |
| DCTPep00735 | I-9 | VKRFKLFFRKLKSV | 14 | cationic host defense peptides |
| DCTPep00736 | I-11 | VRRFRLFFRRLRRSV | 15 | cationic host defense peptides |
| DCTPep00737 | I-10 | VRRFRRFFLRLRRSV | 15 | cationic host defense peptides |
| DCTPep00738 | I-4 | VRRFRRFFRRLRRSV | 15 | cationic host defense peptides |
| DCTPep00739 | I-5 | VRRFRRFFRRLRRSVL | 16 | cationic host defense peptides |
| DCTPep00740 | I-6 | VRRFRRFFRRLRRSVLL | 17 | cationic host defense peptides |
| DCTPep00741 | Tricyclon-A | GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN | 33 | Viola odorata |
| DCTPep00742 | MCoTI-II | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | 34 | Momordica cochinchinensis |
| DCTPep00743 | MCoTI-I | GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD | 34 | Momordica cochinchinensis |
| DCTPep00744 | Cyclotide cter-E | GIPCAESCVWIPCTVTALLGCSCKDKVCYLD | 31 | Clitoria ternatea |
| DCTPep00745 | Cycloviolacin O3 | GIPCGESCVWIPCLTSAIGCSCKSKVCYRN | 30 | Viola odorata |
| DCTPep00746 | Cyclotide cter-G | GLPCGESCVFIPCITTVVGCSCKNKVCYNN | 30 | Clitoria ternatea |
| DCTPep00747 | Kalata-B13 | GLPVCGETCFGGTCNTPGCACDPWPVCTRD | 30 | Oldenlandia affinis |
| DCTPep00748 | Kalata B7 [Y15S] | GLPVCGETCTLGTCSTQGCTCSWPICKRN | 29 | Synthetic |
| DCTPep00749 | Cycloviolacin-O19 | GTLPCGESCVWIPCISSVVGCSCKSKVCYKD | 31 | Viola odorata |
| DCTPep00752 | temporin-ITa | FLGAIAQALTSLLGKL | 16 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DCTPep00753 | Brevinin-1ITa | IVPFLLGMVPKLVCLITKKC | 20 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DCTPep00754 | [R4A,R18A]cGm | GCRALCYKQRCVTYCRGA | 18 | Redesigned Spider Peptide |
| DCTPep00755 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00756 | [Y7W,K8R,Y14W]cGm | GCRRLCWRQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00757 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | 18 | Redesigned Spider Peptide |
This work is licensed under a Creative Commons Attribution 4.0 International License.