This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00267 | Protegrin 1 | RGGRLCYCRRRFCVCVGR | 18 | Alpha helical peptide without cysteines |
| DCTPep00269 | DI | LTFEHYWAQLTS | 12 | E3 ubiquitin-protein ligase |
| DCTPep00271 | P5317-28 | QETFSDLWKLLP | 12 | E3 ubiquitin-protein ligase |
| DCTPep00272 | MIP(F3A) | PRAWEYWLRLME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00275 | MIP(R9A) | PRFWEYWLALME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00276 | MIP(L10A) | PRFWEYWLRAME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00277 | MIP(M11A) | PRFWEYWLRLAE | 12 | E3 ubiquitin-protein ligase |
| DCTPep00278 | MIP | PRFWEYWLRLME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00279 | Vaby A(1) | GLPVCGETCAGGTCNTPGCSCSWPICTRN | 29 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00280 | Vaby D(4) | GLPVCGETCFGGTCNTPGCTCDPWPVCTRN | 30 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00281 | LTX-302 | WKKWXKKWK | 9 | Synthetic |
| DCTPep00282 | LTX-315 | KKWWKKWXK | 9 | Synthetic |
| DCTPep00283 | LTX-318 | XXWXXXWWX | 9 | Synthetic |
| DCTPep00284 | Cliotides T2, CT2 | GEFLKCGESCVQGECYTPGCSCDWPICKKN | 30 | Clitoria ternatea |
| DCTPep00285 | Cliotides T4, CT4 | GIPCGESCVFIPCITAAIGCSCKSKVCYRN | 30 | Clitoria ternatea |
| DCTPep00286 | Cliotides T1, CT1 | GIPCGESCVFIPCITGAIGCSCKSKVCYRN | 30 | Clitoria ternatea |
| DCTPep00287 | Cliotides T3, CT3 | GLPTCGETCTLGTCYVPDCSCSWPICMKN | 29 | Clitoria ternatea |
| DCTPep00288 | Viphi A | GSIPCGESCVFIPCISSVIGCACKSKVCYKN | 31 | Viola philippica |
| DCTPep00289 | Mram 8 | GIPCGESCVFIPCLTSAIGCSCKSKVCYRN | 30 | Viola philippica |
| DCTPep00290 | Viphi D | GIPCGESCVFIPCISSVIGCSCSSKVCYRN | 30 | Viola philippica |
| DCTPep00291 | Viphi E | GSIPCGESCVFIPCISAVIGCSCSNKVCYKN | 31 | Viola philippica |
| DCTPep00292 | Viphi F | GSIPCGESCVFIPCISAIIGCSCSSKVCYKN | 31 | Viola philippica |
| DCTPep00293 | Viphi G | GSIPCGESCVFIPCISAIIGCSCSNKVCYKN | 31 | Viola philippica |
| DCTPep00294 | Viba 17 | GLPVCGETCVGGTCNTPGCGCSWPVCTRN | 29 | Viola philippica |
| DCTPep00295 | Viba 15 | GLPVCGETCVGGTCNTPGCACSWPVCTRN | 29 | Viola philippica |
| DCTPep00296 | Kalata B1 | GLPVCGETCVGGTCNTPGCTCSWPVCTRN | 29 | Oldenlandia affinis; Viola yedoensis; Viola odorata; Viola baoshanensis |
| DCTPep00297 | NRC-14 | AGWGSIFKHIFKAGKFIHGAIQAHND | 26 | Synthetic |
| DCTPep00300 | NRC-05 | FLGALIKGAIHGGRFIHGMIQNHH | 24 | Pseudopleuronectes americanus |
| DCTPep00301 | NRC-19 | FLGLLFHGVHHVGKWIHGLIHGHH | 24 | Synthetic |
| DCTPep00302 | NRC-15 | GFWGKLFKLGLHGIGLLHLHL | 21 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.