This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep02005 | SOR-C27 | EGKLSSNDTEGGLCKEFLHPSKVDLPR | 27 | Blarina brevicauda |
| DCTPep02006 | SOR-C13 | KEFLHPSKVDLPR | 13 | Blarina brevicauda |
| DCTPep02007 | CCP-Ts sub peptide (14-39) | NEPCDSDGDCCTSSEQCISTGSKYFC | 26 | Tityus serrulatus |
| DCTPep02009 | HAL-2 | GKWMSLLKHILK | 12 | Halictines and their analogs |
| DCTPep02022 | HAL-1 | GMWSKILGHLIR | 12 | Halictines and their analogs |
| DCTPep02037 | EP5, Antimicrobial peptide OEP3121 | ACSAG | 5 | Eisenia fetida (Red wiggler worm) |
| DCTPep02038 | EP3 | AMVGT | 5 | Eisenia fetida |
| DCTPep02067 | Temporin-1DRa | HFLGTLVNLAKKIL | 14 | Rana draytonii |
| DCTPep02083 | Piscidin 1 | FFHHIFRGIVHVGKTIHRLVTG | 22 | Morone saxatilis (Striped bass) (Perca saxatilis) |
| DCTPep02084 | Piscidin 1 Cu2+ | FFHHIFRGIVHVGKTIHRLVTG | 22 | Morone saxatilis (Striped bass) (Perca saxatilis) |
| DCTPep02085 | Piscidin 3 | FIHHIFRGIVHAGRSIGRFLTG | 22 | Morone saxatilis (Striped bass) (Perca saxatilis) |
| DCTPep02086 | Piscidin 3 Cu2+ | FIHHIFRGIVHAGRSIGRFLTG | 22 | Morone saxatilis (Striped bass) (Perca saxatilis) |
| DCTPep02087 | Alyteserin-2a | ILGKLLSTAAGLLSNL | 16 | Alytes obstetricans |
| DCTPep02173 | Cherimolacyclopeptide F | PGMGIYLPM | 9 | Annona cherimola |
| DCTPep02174 | PMAP-23, Myeloid antibacterial peptide 23 | RIIDLLWRVRRPQKPKFVTVWVR | 23 | Sus scrofa |
| DCTPep02268 | Tyrocidine A, TrcA | VXLfPFfNQY | 10 | Bacillus subtilis; Bacillus aneurinolyticus; Bacillus brevis |
| DCTPep02269 | Tyrocidine A1, TrcA1 | VKLfPFfNQY | 10 | Bacillus aneurinolyticus; Bacillus brevis |
| DCTPep02270 | Tyrocidine B, TrcB | VXLfPWfNQY | 10 | Bacillus aneurinolyticus; Bacillus brevis |
| DCTPep02271 | Tyrocidine B1, TrcB1 | VKLfPWfNQY | 10 | Bacillus aneurinolyticus; Bacillus brevis |
| DCTPep02272 | Tyrocidine C, TrcC | VXLfPWwNQY | 10 | Bacillus aneurinolyticus; Bacillus brevis |
| DCTPep02273 | Tyrocidine C1, TrcC1 | VKLfPWwNQY | 10 | Bacillus aneurinolyticus; Bacillus brevis |
| DCTPep02276 | ABP-CM4 | RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI | 35 | Bombyx mori |
| DCTPep02277 | VmCT1-NH2 | FLGALWNVAKSVF | 13 | Vaejovis mexicanus smithi |
| DCTPep02285 | Temporin-1Oc | FLPLLASLFSRLF | 13 | Rana ornativentris |
| DCTPep02286 | Temporin-CPa | IPPFIKKVLTTVF | 13 | Rana capito |
| DCTPep02287 | Pantinin-1 | GILGKLWEGFKSIV | 14 | Pandinus imperator |
| DCTPep02288 | Pantinin-2 | IFGAIWKGISSLL | 13 | Pandinus imperator |
| DCTPep02289 | Pantinin-3 | FLSTIWNGIKSLL | 13 | Pandinus imperator |
| DCTPep02290 | Brevinin-1BYa | FLPILASLAAKFGPKLFCLVTKKC | 24 | Rana boylii |
| DCTPep02295 | Hymenochirin-1B | IKLSPETKDNLKKVLKGAIKGAIAVAKMV | 29 | Hymenochirus boettgeri |
This work is licensed under a Creative Commons Attribution 4.0 International License.