This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00764 | [G1K,K8R]cGm | KCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00765 | [G1K,L5Y,K8R]cGm | KCRRYCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00766 | [C/U,G1K,L5Y,K8R]cGm | KURRYUYRQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DCTPep00768 | Gm | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00769 | Gmred | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DCTPep00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC | 33 | Bovine Lactoferricin |
| DCTPep00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DCTPep00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC | 15 | Bovine Lactoferricin |
| DCTPep00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DCTPep00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC | 23 | Bovine Lactoferricin |
| DCTPep00792 | LfcinB (17-31) | FKARRWQWRMKKLGA | 15 | Bovine Lactoferricin |
| DCTPep00793 | LfcinB (17-31)cyc | CFKARRWQWRMKKLGAXC | 18 | Bovine Lactoferricin |
| DCTPep00794 | LfcinB (20–25) | RRWQWR | 6 | Bovine Lactoferricin |
| DCTPep00795 | LfcinB (20–25)cyc | CRRWQWRXC | 9 | Bovine Lactoferricin |
| DCTPep00796 | LfcinB (20–30) | RWQWRMKKLG | 10 | Bovine Lactoferricin |
| DCTPep00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DCTPep00802 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLA | 22 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00803 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00806 | Temporin-PE | FLPIVAKLLSGLL | 13 | Pelophylax kl.esculentus(Europe edible frog) |
| DCTPep00815 | cMP-C | CLNLKALLAVAKKILC | 16 | wasp venom |
| DCTPep00816 | MP-C | LNLKALLAVAKKIL | 14 | wasp venom |
| DCTPep00817 | tMP-C | RKKRRQRRRLNLKALLAVAKKIL | 23 | wasp venom |
| DCTPep00828 | DPS3 | ALWKDILKNAGKAALNEINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00829 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00830 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00840 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | 23 | skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00841 | R2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | 29 | skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00842 | S-24-R2Plx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | 28 | skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00843 | I192F | GCRLYGFKFHGCG | 13 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.