This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00513 | [D9k]Hymenochirin-1Pa | LKLSPKTKkTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00514 | Mastoparan | INLKALAALAKKIL | 14 | Vespula lewisii |
| DCTPep00515 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | 27 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00516 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00585 | Pseudhymenochirin-2Pa [E27K] | GIFPIFAKLLGKVIKVASSLISKGRTK | 27 | Synthetic |
| DCTPep00586 | Pseudhymenochirin-1Pb [E17k] | IKIPSFFRNILKKVGKkAVSLIAGALKQS | 29 | Synthetic |
| DCTPep00706 | FR-15 | FRRFFKWFRRFFKFF | 15 | AMP |
| DCTPep00707 | FR11P | FRRFFKWFRRPFKFF | 15 | AMP |
| DCTPep00708 | FR8P | FRRFFKWPRRFFKFF | 15 | AMP |
| DCTPep00709 | FR8, 11P | FRRFFKWPRRPFKFF | 15 | AMP |
| DCTPep00710 | FR4P | FRRPFKWFRRFFKFF | 15 | AMP |
| DCTPep00711 | FR4, 8P | FRRPFKWPRRFFKFF | 15 | AMP |
| DCTPep00752 | temporin-ITa | FLGAIAQALTSLLGKL | 16 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DCTPep00753 | Brevinin-1ITa | IVPFLLGMVPKLVCLITKKC | 20 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DCTPep00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DCTPep00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC | 33 | Bovine Lactoferricin |
| DCTPep00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DCTPep00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC | 15 | Bovine Lactoferricin |
| DCTPep00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DCTPep00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC | 23 | Bovine Lactoferricin |
| DCTPep00792 | LfcinB (17-31) | FKARRWQWRMKKLGA | 15 | Bovine Lactoferricin |
| DCTPep00793 | LfcinB (17-31)cyc | CFKARRWQWRMKKLGAXC | 18 | Bovine Lactoferricin |
| DCTPep00794 | LfcinB (20–25) | RRWQWR | 6 | Bovine Lactoferricin |
| DCTPep00795 | LfcinB (20–25)cyc | CRRWQWRXC | 9 | Bovine Lactoferricin |
| DCTPep00796 | LfcinB (20–30) | RWQWRMKKLG | 10 | Bovine Lactoferricin |
| DCTPep00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DCTPep00858 | HPRP-A1 | FKKLKKLFSKLWNWK | 15 | Synthetic |
| DCTPep00859 | HPRP-A1-iRGD | FKKLKKLFSKLWNWKCRGDKGPDC | 24 | Synthetic |
| DCTPep00860 | HPRP-A1-GG-iRGD | FKKLKKLFSKLWNWKGGCRGDKGPDC | 26 | Synthetic |
| DCTPep00861 | HPRP-A1-GG-RGD | FKKLKKLFSKLWNWKGGRGD | 20 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.