This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00071 | Varv A, Kalata B1 [T20S] | GLPVCGETCVGGTCNTPGCSCSWPVCTRN | 29 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep00072 | Varv F | GVPICGETCTLGTCYTAGCSCSWPVCTRN | 29 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep00073 | Cycloviolacin O2 | GIPCGESCVWIPCISSAIGCSCKSKVCYRN | 30 | Viola odorata |
| DCTPep00074 | Varv H | GLPVCGETCFGGTCNTPGCSCETWPVCSRN | 30 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep00075 | Varv D | GLPICGETCVGGSCNTPGCSCSWPVCTRN | 29 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep00076 | Varv E | GLPICGETCVGGTCNTPGCSCSWPVCTRN | 29 | Viola arvensis (European field pansy) (Field violet) |
| DCTPep00157 | D-K6L9 | LKlLKKLlkKLLkLL | 15 | Host Defense lytic Peptide |
| DCTPep00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DCTPep00212 | Temporin-CEa | FVDLKKIANIINSIF | 15 | skin of the Chinese brown frog, Rana chensinensis |
| DCTPep00244 | Peptide-20 | CSSRTMHHC | 9 | Synthetic |
| DCTPep00258 | EGFR-lytic | YHWYGYTPQNVIGGGKLlLKlLKKLLKlLKKK | 32 | Synthetic |
| DCTPep00312 | Lytic | KLlLKlLkkLLKlLKKK | 17 | Transferrin receptor (TfR) |
| DCTPep00313 | Transferrin receptor (TfR)-lytic hybrid peptide | THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK | 32 | Transferrin receptor (TfR) |
| DCTPep00339 | IL-4Rα-lytic peptide | KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK | 33 | Interleukin-4 receptor a (IL-4Ra) chain |
| DCTPep00444 | 9R | RRRRRNWMWC | 10 | Nullomer derived anticancer peptides (NulloPs): |
| DCTPep00445 | 9S1R | RRRRRWCMNW | 10 | Nullomer derived anticancer peptides (NulloPs): |
| DCTPep00446 | Adenoregulin (DRS B2) | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | 33 | South American frog Phyllomedusa bicolor |
| DCTPep00458 | Temporin-1CEa LK2(5) | FKDLKKIANIINSIFKK | 17 | Synthetic construct |
| DCTPep00459 | Temporin-1CEa LK3 | FKKLKKIANIINSIFKK | 17 | Synthetic construct |
| DCTPep00460 | Temporin-1CEa LK1 | FVDLKKIANIINSIFKK | 17 | Synthetic construct |
| DCTPep00461 | Temporin-1CEa LK2(6) | FVKLKKIANIINSIFKK | 17 | Synthetic construct |
| DCTPep00462 | Temporin-1CEa LK2(6)AN(2L) | FVKLKKILNIILSIFKK | 17 | Synthetic construct |
| DCTPep00463 | Temporin-1CEa LK2(6)A(L) | FVKLKKILNIINSIFKK | 17 | Synthetic construct |
| DCTPep00490 | cyclosaplin | RLGDGCTR | 8 | somatic seedlings of sandalwood |
| DCTPep00507 | Toxin F-VIII | MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE | 60 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DCTPep00508 | Toxin C13S1C1 | RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN | 59 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DCTPep00509 | 3-OH-C16-KKKK | KKKK | 4 | Synthetic |
| DCTPep00510 | C16-KKKK | KKKK | 4 | Synthetic |
| DCTPep00511 | Hymenochirin-1Pa | LKLSPKTKDTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00512 | [D9K]Hymenochirin-1Pa | LKLSPKTKKTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
This work is licensed under a Creative Commons Attribution 4.0 International License.