This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00746 | Cyclotide cter-G | GLPCGESCVFIPCITTVVGCSCKNKVCYNN | 30 | Clitoria ternatea |
| DCTPep00747 | Kalata-B13 | GLPVCGETCFGGTCNTPGCACDPWPVCTRD | 30 | Oldenlandia affinis |
| DCTPep00749 | Cycloviolacin-O19 | GTLPCGESCVWIPCISSVVGCSCKSKVCYKD | 31 | Viola odorata |
| DCTPep00750 | [D-Trp]CJ-15,208 | FpFw | 4 | Synthetic |
| DCTPep00751 | CJ-15,208 | FpFW | 4 | Synthetic |
| DCTPep00752 | temporin-ITa | FLGAIAQALTSLLGKL | 16 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DCTPep00753 | Brevinin-1ITa | IVPFLLGMVPKLVCLITKKC | 20 | skin secretions of the Italian stream frog Rana italica (Ranidae) |
| DCTPep00754 | [R4A,R18A]cGm | GCRALCYKQRCVTYCRGA | 18 | Redesigned Spider Peptide |
| DCTPep00755 | [Y7W]cGm | GCRRLCWKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00756 | [Y7W,K8R,Y14W]cGm | GCRRLCWRQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00757 | [Y14W]cGm | GCRRLCYKQRCVTWCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00758 | [DPLP]cGm | GCRRLCYKQRCVTYCRGpPR | 20 | Redesigned Spider Peptide |
| DCTPep00759 | cGm | GCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00760 | [K8R]cGm | GCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00761 | [L5W]cGm | GCRRWCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00762 | [C/U]cGm | GURRLUYKQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DCTPep00763 | Cyclic Gomesin [PYA1G, C2,6,11,15SeCys] | GXRRLXYKQRXVTYXRGR | 18 | Synthetic |
| DCTPep00764 | [G1K,K8R]cGm | KCRRLCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00765 | [G1K,L5Y,K8R]cGm | KCRRYCYRQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00766 | [C/U,G1K,L5Y,K8R]cGm | KURRYUYRQRUVTYURGR | 18 | Redesigned Spider Peptide |
| DCTPep00767 | Cyclic Gomesin [PYA1K;C2,6,11,15SeCys;L5Y;K8R] | KXRRYXYRQRXVTYXRGR | 18 | Synthetic |
| DCTPep00768 | Gm | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00769 | Gmred | XCRRLCYKQRCVTYCRGR | 18 | Redesigned Spider Peptide |
| DCTPep00770 | As-CATH4 | RRGLFKKLRRKIKKGFKKIFKRLPPVGVGVSIPLAGRR | 38 | Alligator sinensis |
| DCTPep00771 | Lavracin | WDPYFAGVKKLTKAILAVRA | 20 | Synthetic |
| DCTPep00772 | Lavracin [D2G,P3K,Y4F] | WGKFFAGVKKLTKAILAVRA | 20 | Synthetic |
| DCTPep00774 | Lavracin [D2G,P3K,Y4F,A17G,V18E,R19I] | WGKFFAGVKKLTKAILGEIA | 20 | Synthetic |
| DCTPep00775 | L-K6 | IKKILSKIKKLLK | 13 | some cationic antimicrobial peptides |
| DCTPep00776 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | 19 | Pithecopus hypochondrialis |
| DCTPep00777 | Phylloseptin-PT | FLSLIPKIAGGIAALAKHL | 19 | Phyllomedusa baltea |
This work is licensed under a Creative Commons Attribution 4.0 International License.