This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00779 | Ilamycin B2 | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH16 |
| DCTPep00780 | Ilamycin C | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH21 |
| DCTPep00782 | Ilamycin E | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH25 |
| DCTPep00784 | Bacteriocin ASP-1 | FTVAXFI | 7 | Bacillus subtilis URID 12.1 |
| DCTPep00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DCTPep00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC | 33 | Bovine Lactoferricin |
| DCTPep00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DCTPep00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC | 15 | Bovine Lactoferricin |
| DCTPep00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DCTPep00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC | 23 | Bovine Lactoferricin |
| DCTPep00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DCTPep00800 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | 23 | Phyllomedusa hypochondrialis |
| DCTPep00801 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | 25 | Bombina orientalis |
| DCTPep00802 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLA | 22 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00803 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00804 | PSN-PC | FLSLIPKIATGIAALAKHL | 19 | Phyllomedusa camba |
| DCTPep00806 | Temporin-PE | FLPIVAKLLSGLL | 13 | Pelophylax kl.esculentus(Europe edible frog) |
| DCTPep00807 | Temporin-PE - Tat (48–57) | FLPIVAKLLSGLLGRKKRRQRRR | 23 | Synthetic |
| DCTPep00808 | Temporin-PE [P3Y] | FLYIVAKLLSGLL | 13 | Synthetic |
| DCTPep00810 | Lynronne-1 | LPRRNRWSKIWKKVVTVFS | 19 | Synthetic |
| DCTPep00811 | Lynronne-3 | NRFTARFRRTPWRLCLQFRQ | 20 | Synthetic |
| DCTPep00812 | Brevinin-1DYa | FLSLALAALPKFLCLVFKKC | 20 | Rana dybowskii; Rana huanrenensis; Rana amurensis |
| DCTPep00815 | cMP-C | CLNLKALLAVAKKILC | 16 | wasp venom |
| DCTPep00816 | MP-C | LNLKALLAVAKKIL | 14 | wasp venom |
| DCTPep00817 | tMP-C | RKKRRQRRRLNLKALLAVAKKIL | 23 | wasp venom |
| DCTPep00818 | [Arg]1 -Dec-NH2 | RLLSLIRKLIT | 11 | Synthetic |
| DCTPep00819 | [Phe]2 -Dec-NH2 | SFLSLIRKLIT | 11 | Synthetic |
| DCTPep00820 | [Pro]4 -Dec-NH2 | SLLPLIRKLIT | 11 | Synthetic |
| DCTPep00821 | [Phe]6 -Dec[Thr]11-Dec-NH2 | SLLSLFRKLI | 10 | Synthetic |
| DCTPep00823 | Decoralin, Dec-NH2 | SLLSLIRKLIT | 11 | Oreumenes decoratus |
This work is licensed under a Creative Commons Attribution 4.0 International License.