This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00824 | [Trp]11 -Dec-NH2 | SLLSLIRKLIW | 11 | Synthetic |
| DCTPep00825 | [Leu]11 -Dec-NH2 | SLLSLIRKLLT | 11 | Synthetic |
| DCTPep00827 | Em-Pis1 | FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA | 45 | Epinephelus coioides; Epinephelus malabaricus |
| DCTPep00828 | DPS3 | ALWKDILKNAGKAALNEINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00829 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00830 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00831 | LP-61 | IEELIKKSEEQQKKNEEELKKLEX | 24 | Synthetic |
| DCTPep00832 | LP-65 | IEELLKKAEEQQKKNEEELKKLEX | 24 | Synthetic |
| DCTPep00833 | LP-51 | LEANIEELLKKAEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00834 | LP-52 | WEQKIEELLKKAEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00835 | LP-80 | WEQKIEELLKKAEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00836 | LP-50 | YTSLIEELIKKSEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00837 | LP-40 | YTSLIHSLIEESQNQQEKNEQELLELDX | 28 | Synthetic |
| DCTPep00838 | VGB | CIKPHQGQHICNDE | 14 | Synthetic |
| DCTPep00839 | PE-BBI | GALKGCWTKSIPPKPCK | 17 | skin secretion of Pelophylax esculentus (PE) named PE-BBI |
| DCTPep00840 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | 23 | skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00841 | R2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | 29 | skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00842 | S-24-R2Plx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | 28 | skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00843 | I192F | GCRLYGFKFHGCG | 13 | Synthetic |
| DCTPep00844 | H193F | GCRLYGFKIFGCG | 13 | Synthetic |
| DCTPep00845 | Pc | GCRLYGFKIHGCG | 13 | Synthetic |
| DCTPep00846 | H193W | GCRLYGFKIWGG | 12 | Synthetic |
| DCTPep00847 | I192W | GCRLYGFKWHGCG | 13 | Synthetic |
| DCTPep00848 | L187V | GCRVYGFKIHGCG | 13 | Synthetic |
| DCTPep00850 | LyeTxI-b | IWLTALKFLGKNLGKLAKQQLAKL | 24 | Lycosa erythrognatha spider venom |
| DCTPep00851 | PACAP | HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK | 38 | Synthetic |
| DCTPep00852 | TP III | KWCFRVCYRGICYRKCR | 17 | horseshoe crab Limulus polyphemus |
| DCTPep00853 | TP I | KWCFRVCYRGICYRRCR | 17 | horseshoe crab Limulus polyphemus |
| DCTPep00854 | PM III | RRGCFRVCYRGFCFQRCR | 18 | horseshoe crab Limulus polyphemus |
| DCTPep00855 | PM II | RRWCFRVCYKGFCYRKCR | 18 | horseshoe crab Limulus polyphemus |
This work is licensed under a Creative Commons Attribution 4.0 International License.