This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00783 | Ilamycin F | XXLXAXX | 7 | Streptomyces atratus SCSIO ZH25 |
| DCTPep00784 | Bacteriocin ASP-1 | FTVAXFI | 7 | Bacillus subtilis URID 12.1 |
| DCTPep00786 | LfcinB (17-31)2 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX | 32 | Bovine Lactoferricin |
| DCTPep00787 | LfcinB (17-31)4 | FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC | 33 | Bovine Lactoferricin |
| DCTPep00788 | LfcinB (20–25)2 | RRWQWRRRWQWRKX | 14 | Bovine Lactoferricin |
| DCTPep00789 | LfcinB (20–25)4 | RRWQWRRRWQWRKXC | 15 | Bovine Lactoferricin |
| DCTPep00790 | LfcinB (20–30)2 | RWQWRMKKLGRWQWRMKKLGKX | 22 | Bovine Lactoferricin |
| DCTPep00791 | LfcinB (20–30)4 | RWQWRMKKLGRWQWRMKKLGKXC | 23 | Bovine Lactoferricin |
| DCTPep00792 | LfcinB (17-31) | FKARRWQWRMKKLGA | 15 | Bovine Lactoferricin |
| DCTPep00793 | LfcinB (17-31)cyc | CFKARRWQWRMKKLGAXC | 18 | Bovine Lactoferricin |
| DCTPep00794 | LfcinB (20–25) | RRWQWR | 6 | Bovine Lactoferricin |
| DCTPep00795 | LfcinB (20–25)cyc | CRRWQWRXC | 9 | Bovine Lactoferricin |
| DCTPep00796 | LfcinB (20–30) | RWQWRMKKLG | 10 | Bovine Lactoferricin |
| DCTPep00797 | LfcinB (20–30)cyc | CRWQWRMKKLGXC | 13 | Bovine Lactoferricin |
| DCTPep00800 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | 23 | Phyllomedusa hypochondrialis |
| DCTPep00801 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF | 25 | Bombina orientalis |
| DCTPep00802 | Bombinin-BO1 | GIGSAILSAGKSIIKGLAKGLA | 22 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00803 | Bombinin H-BO1 | IIGPVLGLVGKALGGLL | 17 | skin secretion of Oriental fire-bellied toad, Bombina orientalis |
| DCTPep00804 | PSN-PC | FLSLIPKIATGIAALAKHL | 19 | Phyllomedusa camba |
| DCTPep00805 | HD5 | ATCYCRTGRCATRESLSGVCEISGRLYRLCCR | 32 | Homo sapiens |
| DCTPep00806 | Temporin-PE | FLPIVAKLLSGLL | 13 | Pelophylax kl.esculentus(Europe edible frog) |
| DCTPep00812 | Brevinin-1DYa | FLSLALAALPKFLCLVFKKC | 20 | Rana dybowskii; Rana huanrenensis; Rana amurensis |
| DCTPep00815 | cMP-C | CLNLKALLAVAKKILC | 16 | wasp venom |
| DCTPep00816 | MP-C | LNLKALLAVAKKIL | 14 | wasp venom |
| DCTPep00817 | tMP-C | RKKRRQRRRLNLKALLAVAKKIL | 23 | wasp venom |
| DCTPep00823 | Decoralin, Dec-NH2 | SLLSLIRKLIT | 11 | Oreumenes decoratus |
| DCTPep00827 | Em-Pis1 | FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA | 45 | Epinephelus coioides; Epinephelus malabaricus |
| DCTPep00828 | DPS3 | ALWKDILKNAGKAALNEINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00829 | L10, 11-DPS3 | ALWKDILKNLLKAALNEINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
| DCTPep00830 | K5, 17-DPS3 | ALWKKILKNAGKAALNKINQIVQ | 23 | skin secretion of Phyllomedusa sauvagii |
This work is licensed under a Creative Commons Attribution 4.0 International License.