This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01002 | Linear Desmethoxymajusculamide C | XXGXGXXXA | 9 | Synthetic |
| DCTPep01003 | Ovalbumin (277-287)[V5R, P8R, K11I] | RKIKRYLRRMI | 11 | Synthetic |
| DCTPep01004 | Ovalbumin (277-287) | RKIKVYLPRMK | 11 | Synthetic |
| DCTPep01005 | Esculentin (1-21) | GIFSKLAGKKIKNLLISGLKG | 21 | Synthetic |
| DCTPep01007 | Esculentin (1-18) | GIFSKLAGKKLKNLLISG | 18 | Synthetic |
| DCTPep01008 | Granuliberin-SSa | FIFLPIFRRPVS | 12 | Glandirana susurra |
| DCTPep01009 | Ranatuerin-2SSa | GLISTIWNTASNVAGTLTDSVKCKFKKC | 28 | Glandirana susurra |
| DCTPep01010 | Brevinin-2SSb | SLFSLIKAGAKFLGKNMLKQGPQYPACKVSKDSENVNWKS | 40 | Glandirana susurra |
| DCTPep01011 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DCTPep01012 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | 21 | skin secretion of Amolops hainanensis |
| DCTPep01013 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DCTPep01014 | B18K | GFQKVKAQAATCNHTVMA | 18 | Synthetic |
| DCTPep01015 | B18KA | GFQKAKAKALACLAKALA | 18 | Synthetic |
| DCTPep01016 | B18KL | GFQKVKAQALTCLHTVMA | 18 | Synthetic |
| DCTPep01017 | B18I | GIGKAIAKAIACIAKAIA | 18 | Synthetic |
| DCTPep01018 | B18L | GLGKALAKALACLAKALA | 18 | Synthetic |
| DCTPep01019 | Temporin-SHe | FLPALAGIAGLLGKIF | 16 | Pelophylax saharicus |
| DCTPep01020 | Figainin 1 | FIGTLIPLALGALTKLFK | 18 | B. raniceps skin secretion |
| DCTPep01021 | C1 | CKKKC | 5 | Synthetic |
| DCTPep01022 | C6 | CKKKRC | 6 | Synthetic |
| DCTPep01023 | C5 | CKKRKC | 6 | Synthetic |
| DCTPep01024 | C3 | CRKKKC | 6 | Synthetic |
| DCTPep01025 | L6 | KKKR | 4 | Synthetic |
| DCTPep01026 | L5 | KKRK | 4 | Synthetic |
| DCTPep01027 | L3 | RKKK | 4 | Synthetic |
| DCTPep01028 | vCPP 2319 | WRRRYRRWRRRRRWRRRPRR | 20 | Synthetic |
| DCTPep01029 | Del1 | RRIPFWPIPLRWQWPPPWFPPSFPIPRISRKR | 32 | Synthetic |
| DCTPep01030 | Orc1 | RRIPFWPPNLPGPRRPPWFLPDFRIPRIPRKR | 32 | Synthetic |
| DCTPep01031 | Cathelicidin Neo1 | RRIRFPFPPFPWQWPPAGFPTFHIPRIPRKQ | 31 | Synthetic |
| DCTPep01032 | Cathelicidin-like peptide Bal1 | RRIRFRPPRLPRPRPRPWIPPRFPFPRIPGKR | 32 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.