This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00017 | maximin 4 | GIGGVLLSAGKAALKGLAKVLAEKYAN | 27 | Bombina maxima |
| DCTPep00049 | FIV-NCSU1 HR2 T1972 (734-768) | EWYNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQLQ | 35 | Synthetic |
| DCTPep00050 | FIV-NCSU1 HR2 T1971 (733-767) | GEWYNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQL | 35 | Synthetic |
| DCTPep00051 | Alloferon 2 | GVSGHGQHGVHG | 12 | the blow fly Calliphora vicina (Diptera) |
| DCTPep00052 | Alloferon 1 | HGVSGHGQHGVHG | 13 | the blow fly Calliphora vicina (Diptera) |
| DCTPep00106 | Gymnin | KTCENLADDY | 10 | Gymnocladus chinensis |
| DCTPep00121 | Coccinin | KQTENLADTY | 10 | Phaseolus coccineus |
| DCTPep00143 | Antifungal lectin PVAP | SNDIYFNFQR | 10 | Phaseolus vulgaris |
| DCTPep00246 | R7 | RRRRRRR | 7 | Synthetic |
| DCTPep00296 | Kalata B1 | GLPVCGETCVGGTCNTPGCTCSWPVCTRN | 29 | Oldenlandia affinis; Viola yedoensis; Viola odorata; Viola baoshanensis |
| DCTPep00451 | Caseinphosphopeptides | PPPEE | 5 | Bovine milk |
| DCTPep00452 | αs1-casein f(90_95) | RYLGYL | 6 | Bovine milk |
| DCTPep00453 | β-Casomorphins 5 f(60_64) | YPFPG | 5 | Bovine milk |
| DCTPep00476 | Drosocin-1 | GKPRPYSPRPTSHPRPIRV | 19 | Drosophila melanogaster; Drosophila simulans |
| DCTPep00484 | BP76, Cecropin A (2-8)[W2K] + Melittin (6-9)[V8F] | KKLFKKILKFL | 11 | Synthetic |
| DCTPep00485 | Dermaseptin S4 [M4D][N20D] | ALWDTLLKKVLKAAAKAALDAVLVGANA | 28 | Synthetic |
| DCTPep00487 | Dermaseptin S4 [M4K][N20K] | ALWKTLLKKVLKAAAKAALKAVLVGANA | 28 | Synthetic |
| DCTPep00488 | Dermaseptin S4 [M4K] | ALWKTLLKKVLKAAAKAALNAVLVGANA | 28 | Synthetic |
| DCTPep00489 | Dermaseptin S4 (5-28) | TLLKKVLKAAAKAALNAVLVGANA | 24 | Synthetic |
| DCTPep00669 | Cyclosporin A | XXXVXAaXXXX | 11 | Tolypocladium inflatum |
| DCTPep00695 | Temporin-1Tb | LLPIVGNLLKSLL | 13 | Rana temporaria |
| DCTPep00805 | HD5 | ATCYCRTGRCATRESLSGVCEISGRLYRLCCR | 32 | Homo sapiens |
| DCTPep00813 | LL-37 fragment KR-12 | KRIVQRIKDFLR | 12 | Synthetic |
| DCTPep00831 | LP-61 | IEELIKKSEEQQKKNEEELKKLEX | 24 | Synthetic |
| DCTPep00832 | LP-65 | IEELLKKAEEQQKKNEEELKKLEX | 24 | Synthetic |
| DCTPep00833 | LP-51 | LEANIEELLKKAEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00834 | LP-52 | WEQKIEELLKKAEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00835 | LP-80 | WEQKIEELLKKAEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00836 | LP-50 | YTSLIEELIKKSEEQQKKNEEELKKLEX | 28 | Synthetic |
| DCTPep00837 | LP-40 | YTSLIHSLIEESQNQQEKNEQELLELDX | 28 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.