This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep01087 | P2 | KWKLFKKIGIGKFLHSATTF | 20 | Ceropin A-Magainin 2 |
| DCTPep01088 | P3 | KWKLFKKIGIGAFLHSAKKF | 20 | Ceropin A-Magainin 2 |
| DCTPep01089 | P4 | KWKLFKKIGIGKFLHLAKKF | 20 | Ceropin A-Magainin 2 |
| DCTPep01090 | P5 | KWKLFKKIGIGAFLHLAKKF | 20 | Ceropin A-Magainin 2 |
| DCTPep01091 | P6 | KWKLFKKIGIGKFKLAKKF | 19 | Ceropin A-Magainin 2 |
| DCTPep01092 | P7 | KWKLFAKIGIGKFLHLAKKF | 20 | Ceropin A-Magainin 2 |
| DCTPep01093 | P8 | KWKKFLKIGIGKFLHLAKKF | 20 | Ceropin A-Magainin 2 |
| DCTPep01094 | DRS B4 | ALWKDILKNVGKAAGKAVLNTVTDMVNQ | 28 | Dermaseptins B |
| DCTPep01095 | DRS B3 | ALWKNMLKGIGKLAGQAALGAVKTLVGA | 28 | Dermaseptins B |
| DCTPep01098 | CPe-III(CPe-III-S) | RQSHFANAQP | 10 | Chickpea (Cicer arietinum L.) |
| DCTPep01099 | BCP-A | WPP | 3 | hydrolysate of blood clam (Tegillarca granosa) muscle |
| DCTPep01100 | P19 | SLPQNIPPLTQTPVVVPPF | 19 | Synbiotic yoghurt |
| DCTPep01101 | P17 | YQEPVLGPVRGPFPIIV | 17 | Synbiotic yoghurt |
| DCTPep01102 | Brevilaterin B | XXMXIVVKVLKYLX | 14 | Brevibacillus laterosporus |
| DCTPep01103 | INKKI peptide | INKKI | 5 | β-Casein |
| DCTPep01104 | Hepcidin TH1-5 | GIKCRFCCGCCTPGICGVCCRF | 22 | Skin Secretion of the African Frog, Kassina senegalensis |
| DCTPep01105 | ND2 | GLFDIVKGIKSLF | 13 | Synthetic |
| DCTPep01106 | ND3 | GLFDIVKKIKSLF | 13 | Synthetic |
| DCTPep01107 | ND4 | GLFDIVKKLKSLF | 13 | Synthetic |
| DCTPep01109 | ND1 | GLFDIWKGIKSLF | 13 | Synthetic |
| DCTPep01111 | DN1 | ILGKIVKKLVSDF | 13 | Synthetic |
| DCTPep01112 | IsCT | ILGKIWKGIKSLF | 13 | Synthetic |
| DCTPep01113 | DN4 | ILGKIWKGIVSDF | 13 | Synthetic |
| DCTPep01117 | YALPAG | YALPAG | 6 | Heated products of peptic hydrolysates of half-fin anchovy (Setipinna taty) |
| DCTPep01119 | YALPAR | YALPAR | 6 | Heated products of peptic hydrolysates of half-fin anchovy (Setipinna taty) |
| DCTPep01120 | YALRAH | YALRAH | 6 | Heated products of peptic hydrolysates of half-fin anchovy (Setipinna taty) |
| DCTPep01121 | Lycosin-II | VWLSALKFIGKHLAKHQLSKL | 21 | Synthetic |
| DCTPep01123 | VKVR | VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG | 65 | Scorpion |
| DCTPep01124 | YALPAH | YALPAH | 6 | Yellow crucian carp protein |
| DCTPep01126 | CMAP-L-252 | KFKKFFKFMVKKKKF | 15 | Not available |
This work is licensed under a Creative Commons Attribution 4.0 International License.