| DCTPep00149 |
Brevinin-1DYb |
FLSLALAALPKLFCLIFKKC |
20 |
Rana dybowskii; Rana pirica; Rana amurensis |
| DCTPep00776 |
Phylloseptin-PHa |
FLSLIPAAISAVSALANHF |
19 |
Pithecopus hypochondrialis |
| DCTPep00800 |
Dermaseptin-PH |
ALWKEVLKNAGKAALNEINNLVQ |
23 |
Phyllomedusa hypochondrialis |
| DCTPep00806 |
Temporin-PE |
FLPIVAKLLSGLL |
13 |
Pelophylax kl.esculentus(Europe edible frog) |
| DCTPep00807 |
Temporin-PE - Tat (48–57) |
FLPIVAKLLSGLLGRKKRRQRRR |
23 |
Synthetic |
| DCTPep00808 |
Temporin-PE [P3Y] |
FLYIVAKLLSGLL |
13 |
Synthetic |
| DCTPep00812 |
Brevinin-1DYa |
FLSLALAALPKFLCLVFKKC |
20 |
Rana dybowskii; Rana huanrenensis; Rana amurensis |
| DCTPep00815 |
cMP-C |
CLNLKALLAVAKKILC |
16 |
wasp venom |
| DCTPep00816 |
MP-C |
LNLKALLAVAKKIL |
14 |
wasp venom |
| DCTPep00817 |
tMP-C |
RKKRRQRRRLNLKALLAVAKKIL |
23 |
wasp venom |
| DCTPep00840 |
R2PLx-22 |
GIMDTVKNAAKNLAGQLLDKLK |
23 |
skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00841 |
R2PLx |
GIMDTVKNAAKNLAGQLLDKLKCKITAC |
29 |
skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00842 |
S-24-R2Plx |
GIMDTVKNAAKNLAGQLLDKLKCSITAC |
28 |
skin secretions of the pickerel frog (Rana palustris) |
| DCTPep00912 |
[W2S]cTI |
KSCFRVCYRGICYRRCRG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00913 |
[R/K]cTI |
KWCFKVCYKGICYKKCKG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00914 |
[Y8S-I11S]cTI |
KWCFRVCSRGSCYRRCRG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00916 |
TI |
KWCFRVCYRGICYRRCR |
17 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00917 |
cTI |
KWCFRVCYRGICYRRCRG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00919 |
[R17S]cTI |
KWCFRVCYRGICYRRCSG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00920 |
[R14S]cTI |
KWCFRVCYRGICYSRCRG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00921 |
[R9S]cTI |
KWCFRVCYSGICYRRCRG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep00923 |
[F4S-Y13S]cTI |
KWCSRVCYRGICSRRCRG |
18 |
host defense peptide from the horseshoe crab Tachypleus tridentatus |
| DCTPep01011 |
Brevinin-1H |
FALGAVTKVLPKLFCLITRKC |
21 |
skin secretion of Amolops hainanensis |
| DCTPep01012 |
Brevinin-1Ha |
FALGAVTCLIRTKCKVLPKLF |
21 |
skin secretion of Amolops hainanensis |
| DCTPep01013 |
Brevinin-1HY |
FALGAVTKVLYKLFCLITRKC |
21 |
skin secretion of Amolops hainanensis |
| DCTPep02004 |
APETx4 |
GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD |
42 |
Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima) |
| DCTPep02843 |
cHLH-p53R |
GARELRRLERELRRLEGGGGGGGKLAALKFKLLWLKLAC |
39 |
Synthetic |
| DCTPep02844 |
[G17K]cHLH-p53R |
GARELRRLERELRRLEKGGGGGGKLAALKFKLLWLKLAC |
39 |
Synthetic |
| DCTPep02845 |
cHLH-pDI1-R |
GARELRRLERELRRLEKGGGGGGKLAALTFEHYWAQLTSC |
40 |
Synthetic |
| DCTPep02846 |
[F30A]cHLH-p53-R |
GARELRRLERELRRLEGGGGGGGKLAALKAKLLWLKLAC |
39 |
Synthetic |