| DCTPep00149 | Brevinin-1DYb | FLSLALAALPKLFCLIFKKC | 20 | Rana dybowskii; Rana pirica; Rana amurensis | 
 
                | DCTPep00776 | Phylloseptin-PHa | FLSLIPAAISAVSALANHF | 19 | Pithecopus hypochondrialis | 
 
                | DCTPep00800 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | 23 | Phyllomedusa hypochondrialis | 
 
                | DCTPep00806 | Temporin-PE | FLPIVAKLLSGLL | 13 | Pelophylax kl.esculentus(Europe edible frog) | 
 
                | DCTPep00807 | Temporin-PE - Tat (48–57) | FLPIVAKLLSGLLGRKKRRQRRR | 23 | Synthetic | 
 
                | DCTPep00808 | Temporin-PE [P3Y] | FLYIVAKLLSGLL | 13 | Synthetic | 
 
                | DCTPep00812 | Brevinin-1DYa | FLSLALAALPKFLCLVFKKC | 20 | Rana dybowskii; Rana huanrenensis; Rana amurensis | 
 
                | DCTPep00815 | cMP-C | CLNLKALLAVAKKILC | 16 | wasp venom | 
 
                | DCTPep00816 | MP-C | LNLKALLAVAKKIL | 14 | wasp venom | 
 
                | DCTPep00817 | tMP-C | RKKRRQRRRLNLKALLAVAKKIL | 23 | wasp venom | 
 
                | DCTPep00840 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | 23 | skin secretions of the pickerel frog (Rana palustris) | 
 
                | DCTPep00841 | R2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | 29 | skin secretions of the pickerel frog (Rana palustris) | 
 
                | DCTPep00842 | S-24-R2Plx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | 28 | skin secretions of the pickerel frog (Rana palustris) | 
 
                | DCTPep00912 | [W2S]cTI | KSCFRVCYRGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00913 | [R/K]cTI | KWCFKVCYKGICYKKCKG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00914 | [Y8S-I11S]cTI | KWCFRVCSRGSCYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00916 | TI | KWCFRVCYRGICYRRCR | 17 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00917 | cTI | KWCFRVCYRGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00919 | [R17S]cTI | KWCFRVCYRGICYRRCSG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00920 | [R14S]cTI | KWCFRVCYRGICYSRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00921 | [R9S]cTI | KWCFRVCYSGICYRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep00923 | [F4S-Y13S]cTI | KWCSRVCYRGICSRRCRG | 18 | host defense peptide from the horseshoe crab Tachypleus tridentatus | 
 
                | DCTPep01011 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | 21 | skin secretion of Amolops hainanensis | 
 
                | DCTPep01012 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | 21 | skin secretion of Amolops hainanensis | 
 
                | DCTPep01013 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | 21 | skin secretion of Amolops hainanensis | 
 
                | DCTPep02004 | APETx4 | GTTCYCGKTIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD | 42 | Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima) | 
 
                | DCTPep02843 | cHLH-p53R | GARELRRLERELRRLEGGGGGGGKLAALKFKLLWLKLAC | 39 | Synthetic | 
 
                | DCTPep02844 | [G17K]cHLH-p53R | GARELRRLERELRRLEKGGGGGGKLAALKFKLLWLKLAC | 39 | Synthetic | 
 
                | DCTPep02845 | cHLH-pDI1-R | GARELRRLERELRRLEKGGGGGGKLAALTFEHYWAQLTSC | 40 | Synthetic | 
 
                | DCTPep02846 | [F30A]cHLH-p53-R | GARELRRLERELRRLEGGGGGGGKLAALKAKLLWLKLAC | 39 | Synthetic |