This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00974 | Tritrp-Arg | VRRFPWWWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00975 | Tritrpticin | VRRFPWWWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00976 | Tritrp-W8Y | VRRFPWWYPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00977 | Tritrp-W7Y | VRRFPWYWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00978 | Tritrp-W78Y | VRRFPWYYPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00979 | Tritrp-W6Y | VRRFPYWWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00980 | Tritrp-W68Y | VRRFPYWYPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00981 | Tritrp-W67Y | VRRFPYYWPFLRR | 13 | porcine cathelicidin peptide |
| DCTPep00983 | 12-(Lys)4-12 | KKKK | 4 | Synthetic |
| DCTPep00991 | Hyen D | GFPCGESCVYIPCFTAAIGCSCKSKVCYKN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00992 | Hyen L | GIPCAESCVYIPCTVTALLGCSCSDKVCYN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00994 | Hyen E | GVPCGESCVYIPCFTGIINCSCRDKVCYNN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00995 | Hyen M | SIPCAESCVWIPCTVTALLGCSCSDKVCYN | 30 | medicinal herb Hybanthus enneaspermus |
| DCTPep00996 | Figainin 2 | FLGAILKIGHALAKTVLPMVTNAFKPKQ | 28 | Boana raniceps |
| DCTPep00997 | Dermaseptin-PP | ALWKDMLKGIGKLAGKAALGAVKTLV | 26 | Phyllomedusa palliata Skin Secretions |
| DCTPep00998 | Kassinatuerin-3 | FIQHLIPLIPHAIQGIKDIF | 20 | Skin Secretion of the African Frog, Kassina senegalensis |
| DCTPep00999 | Anoplin [T8Beta-Ala] | GLLKRIKXLL | 10 | Synthetic |
| DCTPep01001 | Desmethoxymajusculamide C | XXGXGXXXA | 9 | Lyngbya majuscula |
| DCTPep01002 | Linear Desmethoxymajusculamide C | XXGXGXXXA | 9 | Synthetic |
| DCTPep01005 | Esculentin (1-21) | GIFSKLAGKKIKNLLISGLKG | 21 | Synthetic |
| DCTPep01008 | Granuliberin-SSa | FIFLPIFRRPVS | 12 | Glandirana susurra |
| DCTPep01009 | Ranatuerin-2SSa | GLISTIWNTASNVAGTLTDSVKCKFKKC | 28 | Glandirana susurra |
| DCTPep01010 | Brevinin-2SSb | SLFSLIKAGAKFLGKNMLKQGPQYPACKVSKDSENVNWKS | 40 | Glandirana susurra |
| DCTPep01011 | Brevinin-1H | FALGAVTKVLPKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DCTPep01012 | Brevinin-1Ha | FALGAVTCLIRTKCKVLPKLF | 21 | skin secretion of Amolops hainanensis |
| DCTPep01013 | Brevinin-1HY | FALGAVTKVLYKLFCLITRKC | 21 | skin secretion of Amolops hainanensis |
| DCTPep01015 | B18KA | GFQKAKAKALACLAKALA | 18 | Synthetic |
| DCTPep01017 | B18I | GIGKAIAKAIACIAKAIA | 18 | Synthetic |
| DCTPep01018 | B18L | GLGKALAKALACLAKALA | 18 | Synthetic |
| DCTPep01019 | Temporin-SHe | FLPALAGIAGLLGKIF | 16 | Pelophylax saharicus |
This work is licensed under a Creative Commons Attribution 4.0 International License.