This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00257 | Ranatuerin-2Lb | GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC | 32 | Rana luteiventris; Rana pretiosa |
| DCTPep00259 | Oncocin [R15,19Orn][I16Tle] | VDKPPYLPRPRPPRXXYNX | 19 | Synthetic |
| DCTPep00260 | Oncocin [P13Hyp][R15Hyp][R19Orn] | VDKPPYLPRPRPXRXIYNX | 19 | Synthetic |
| DCTPep00261 | Oncocin [P13Hyp,R15Hyp,I16Tle,R19Orn] | VDKPPYLPRPRPXRXXYNX | 19 | Synthetic |
| DCTPep00262 | Buforin II | TRSSRAGLQFPVGRVHRLLRK | 21 | Bufo Bufo Gargarizans |
| DCTPep00264 | Demegen P-113 | AKRHHGYKRKFH | 12 | Amphibian skin peptide |
| DCTPep00265 | OmigaNAn MBI-226 | ILRWPWWPWRRK | 12 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00266 | Pexiganan MSI-78 | GIGKFLKKAKKFGKAFVKILKK | 22 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00267 | Protegrin 1 | RGGRLCYCRRRFCVCVGR | 18 | Alpha helical peptide without cysteines |
| DCTPep00268 | Temporin A | FLPLIGRVLSGIL | 13 | Frog Rana temporaria |
| DCTPep00269 | DI | LTFEHYWAQLTS | 12 | E3 ubiquitin-protein ligase |
| DCTPep00270 | 3A | LTAEHYAAQATS | 12 | E3 ubiquitin-protein ligase |
| DCTPep00271 | P5317-28 | QETFSDLWKLLP | 12 | E3 ubiquitin-protein ligase |
| DCTPep00272 | MIP(F3A) | PRAWEYWLRLME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00273 | MIP(Y6A) | PRFWEAWLRLME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00274 | MIP(W7A) | PRFWEYALRLME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00275 | MIP(R9A) | PRFWEYWLALME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00276 | MIP(L10A) | PRFWEYWLRAME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00277 | MIP(M11A) | PRFWEYWLRLAE | 12 | E3 ubiquitin-protein ligase |
| DCTPep00278 | MIP | PRFWEYWLRLME | 12 | E3 ubiquitin-protein ligase |
| DCTPep00279 | Vaby A(1) | GLPVCGETCAGGTCNTPGCSCSWPICTRN | 29 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00280 | Vaby D(4) | GLPVCGETCFGGTCNTPGCTCDPWPVCTRN | 30 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00281 | LTX-302 | WKKWXKKWK | 9 | Synthetic |
| DCTPep00282 | LTX-315 | KKWWKKWXK | 9 | Synthetic |
| DCTPep00283 | LTX-318 | XXWXXXWWX | 9 | Synthetic |
| DCTPep00284 | Cliotides T2, CT2 | GEFLKCGESCVQGECYTPGCSCDWPICKKN | 30 | Clitoria ternatea |
| DCTPep00285 | Cliotides T4, CT4 | GIPCGESCVFIPCITAAIGCSCKSKVCYRN | 30 | Clitoria ternatea |
| DCTPep00286 | Cliotides T1, CT1 | GIPCGESCVFIPCITGAIGCSCKSKVCYRN | 30 | Clitoria ternatea |
| DCTPep00287 | Cliotides T3, CT3 | GLPTCGETCTLGTCYVPDCSCSWPICMKN | 29 | Clitoria ternatea |
| DCTPep00288 | Viphi A | GSIPCGESCVFIPCISSVIGCACKSKVCYKN | 31 | Viola philippica |
This work is licensed under a Creative Commons Attribution 4.0 International License.