| DCTPep03687 |
Distinctin-Like-Peptide-PH, DLP-PH |
NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN |
36 |
Animalia |
| DCTPep03688 |
Cordyheptapeptide A linear |
LIXFXPx |
7 |
Synthetic |
| DCTPep03689 |
Cordyheptapeptide A |
XFXILxP |
7 |
Cordyceps sp. |
| DCTPep03693 |
Stigmurin [S7K,G10K], StigA6 |
FFSLIPKLVKGLISAFK |
17 |
Synthetic |
| DCTPep03694 |
Stigmurin [S3,7K;G10K], StigA16 |
FFKLIPKLVKGLISAFK |
17 |
Synthetic |
| DCTPep03697 |
Fusaripeptide A |
XAaQyI |
6 |
Fusarium |
| DCTPep03710 |
Dermaseptin DRS-DU-1 |
ALWKSLLKNVGKAAGKAALNAVTDMVNQ |
28 |
Animalia |
| DCTPep03712 |
TAT(48-57)-G-Dermaseptin DRS-DU-1 (1-13), DP-2 |
GRKKRRQRRRGALWKSLLKNVGKA |
24 |
Synthetic |
| DCTPep03738 |
Dermaseptin-PS1, Dermaseptin cDNA |
ALWKTMLKKLGTVALHAGKAALGAVADTISQ |
31 |
Animalia |
| DCTPep03748 |
Ranatuerin-2PLx, R2PLx |
GIMDTVKNAAKNLAGQLLDKLKCKITAC |
28 |
Animalia |
| DCTPep03749 |
Ranatuerin-2PLx (1-22), R2PLx (1-22) |
GIMDTVKNAAKNLAGQLLDKLK |
22 |
Synthetic |
| DCTPep03756 |
Antimicrobial peptide 1, Cn-AMP1 |
SVAGRAQGM |
9 |
Synthetic |
| DCTPep03764 |
Phylloseptin-PBa2, Phylloseptin-PBu |
FLSLLPHIASGIASLVSKF |
19 |
Animalia |
| DCTPep03765 |
Phylloseptin-PBa1, Phylloseptin-PBu |
FLSLIPHIASGIASLVKNF |
19 |
Animalia |
| DCTPep03769 |
Esculentin-1GN |
GLFSKKGGKGGKSWIKGVFKGIKGIGKEVGGDVIRTGIEIAACKIKGEC |
49 |
Animalia |
| DCTPep03770 |
Cathelicidin Ps-CATH4 |
TRGRWGRFKRRAGRFIRRNRWQIISTGLKLIG |
32 |
Animalia |
| DCTPep03771 |
CH9 |
WKLLSKAQEKFGKNKSR,RYGTXIYQXRLWAFSK |
34 |
Synthetic |
| DCTPep03772 |
CH10 |
WKLLSKAQEKFGKNKSRC,RYGTCIYQXRLWAFS |
34 |
Synthetic |
| DCTPep03774 |
Cathelicidin Ps-CATH6 |
KKPSKKPKPQAMTFPKVTVEYFPASFSTAALTVPED |
36 |
Animalia |
| DCTPep03801 |
KK-Temporin-B [G6A] |
KKLLPIVANLLKSLL |
15 |
Synthetic |
| DCTPep03807 |
Mitoparan [L14S], Mastoparan [A5,8K;A10Aib;L14S] |
INLKKLAKLXKKIS |
14 |
Synthetic |
| DCTPep03808 |
Mitoparan [K8Orn,L14S], Mastoparan [A5,A8Orn,A10Aib,L14S] |
INLKKLAXLXKKIS |
14 |
Synthetic |
| DCTPep03809 |
Mitoparan [L14T], Mastoparan [A5,8K;A10Aib;L14T] |
INLKKLAKLXKKIT |
14 |
Synthetic |
| DCTPep03820 |
Cecropin-B [E27Q] |
RWKIFKKIEKMGRNIRDGIVKAGPAIQVLGSAKAI |
35 |
Synthetic |
| DCTPep03821 |
Flower-specific gamma-thionin, ZmD32 |
RTCQSQSHRFRGPCLRRSNCANVCRTEGFPGGRCRGFRRRCFCTTHC |
47 |
Plantae |
| DCTPep03822 |
NN2_0018 |
YLARAIRRTLARLLL |
15 |
Synthetic |
| DCTPep03823 |
NN2_0050 |
SWKKFFKKARSLPKLF |
16 |
Synthetic |
| DCTPep03824 |
Cm-CATH2 |
RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF |
33 |
Animalia |
| DCTPep03847 |
LF Brevinin, LFB |
GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC |
33 |
Animalia |
| DCTPep03848 |
Ranatuerin-2Pb |
SFLTTVKKLVTNLAALAGTVIDTIKCKVTGGCRT |
34 |
Animalia |