This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00293 | Viphi G | GSIPCGESCVFIPCISAIIGCSCSNKVCYKN | 31 | Viola philippica |
| DCTPep00294 | Viba 17 | GLPVCGETCVGGTCNTPGCGCSWPVCTRN | 29 | Viola philippica |
| DCTPep00295 | Viba 15 | GLPVCGETCVGGTCNTPGCACSWPVCTRN | 29 | Viola philippica |
| DCTPep00296 | Kalata B1 | GLPVCGETCVGGTCNTPGCTCSWPVCTRN | 29 | Oldenlandia affinis; Viola yedoensis; Viola odorata; Viola baoshanensis |
| DCTPep00300 | NRC-05 | FLGALIKGAIHGGRFIHGMIQNHH | 24 | Pseudopleuronectes americanus |
| DCTPep00305 | NRC-06 | GWGSIFKHGRHAAKHIGHAAVNHYL | 25 | Pseudopleuronectes americanus |
| DCTPep00314 | Brevinin-2DYc | GLFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC | 33 | Rana dybowskii; Rana nigromaculata |
| DCTPep00316 | Cr-ACP1 | AWKLFDDGV | 9 | Cycas revoluta seeds |
| DCTPep00323 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | 25 | Pleurocidin-family |
| DCTPep00334 | Pardaxin | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | 33 | Red Sea Mosessole |
| DCTPep00375 | LL-III | VNWKKILGKIIKVVK | 15 | Lasioglossin III and its analogs |
| DCTPep00394 | Chassatide C8 | AIPCGESCVWIPCISTVIGCSCSNKVCYR | 29 | Chassalia chartacea |
| DCTPep00395 | Chassatide C4 | GASCGETCFTGICFTAGCSCNPWPTCTRN | 29 | Chassalia chartacea |
| DCTPep00396 | Chassatide C10 | GEYCGESCYLIPCFTPGCYCVSRQCVNKN | 29 | Chassalia chartacea |
| DCTPep00397 | Chassatide C2 | GIPCAESCVWIPCTITALMGCSCKNNVCYNN | 31 | Chassalia chartacea |
| DCTPep00399 | Chassatide C1 | GDACGETCFTGICFTAGCSCNPWPTCTRN | 29 | Chassalia chartacea |
| DCTPep00400 | Chassatide C11 | IPCGESCVWIPCISGMFGCSCKDKVCYS | 28 | Chassalia chartacea |
| DCTPep00402 | Chassatide C7 | IPCGESCVWIPCITAIAGCSCKNKVCYT | 28 | Chassalia chartacea |
| DCTPep00403 | P7 | PLLQATLGGGS | 11 | No information found in the references |
| DCTPep00408 | GA-K3 | FLGWLFKWAKK | 11 | Brevinin-1EMa |
| DCTPep00409 | GA-W3 | FLGWLFKWAWK | 11 | Brevinin-1EMa |
| DCTPep00410 | GA-K4 | FLKWLFKWAKK | 11 | Brevinin-1EMa |
| DCTPep00411 | GA-W4 | FLWWLFKWAWK | 11 | Brevinin-1EMa |
| DCTPep00432 | ltc2aG11A | GLFGKLIKKFARKAISYAVKKARGKH | 26 | Central Asian spider, Lachesana tarabaevi |
| DCTPep00433 | Latarcin 2a | GLFGKLIKKFGRKAISYAVKKARGKH | 26 | Central Asian spider, Lachesana tarabaevi |
| DCTPep00444 | 9R | RRRRRNWMWC | 10 | Nullomer derived anticancer peptides (NulloPs): |
| DCTPep00445 | 9S1R | RRRRRWCMNW | 10 | Nullomer derived anticancer peptides (NulloPs): |
| DCTPep00446 | Adenoregulin (DRS B2) | GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV | 33 | South American frog Phyllomedusa bicolor |
| DCTPep00447 | Ranalexin | FLGGLIKIVPAMICAVTKKC | 20 | Rana catesbeiana |
| DCTPep00449 | Alliumin | DDFLCAGGCL | 10 | Allium sativum |
This work is licensed under a Creative Commons Attribution 4.0 International License.