This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00472 | BP307 | RRLFRRILRYL | 11 | Synthetic |
| DCTPep00473 | BP325 | KKLFKKILKKL | 11 | Synthetic |
| DCTPep00474 | Bac2a [L2R][A3W][A11R] | RRWRIVVIRVRR | 12 | Synthetic |
| DCTPep00475 | C -C8 | RWRWRWX | 7 | Synthetic |
| DCTPep00476 | Drosocin-1 | GKPRPYSPRPTSHPRPIRV | 19 | Drosophila melanogaster; Drosophila simulans |
| DCTPep00477 | KilerFLIP-E | YGRKKRRQRRRREADFFWSLCTA | 23 | The C-terminal domain of c-FLIP |
| DCTPep00478 | Short α-helical peptides | GIIKKIIKKI | 10 | Alpha-helical proteins |
| DCTPep00479 | Short α-helical peptides | GIIKKIIKKIIKKI | 14 | Alpha-helical proteins |
| DCTPep00480 | Short α-helical peptides | GIIKKIIKKIIKKIIKKI | 18 | Alpha-helical proteins |
| DCTPep00481 | Cecropin A (2-8) + Melittin (6-9) | WKLFKKILKVL | 11 | Synthetic |
| DCTPep00482 | BP327 | CREKAKKLFKKILKKL | 16 | Synthetic |
| DCTPep00483 | BP308 | RRLFRRILRRL | 11 | Synthetic |
| DCTPep00484 | BP76, Cecropin A (2-8)[W2K] + Melittin (6-9)[V8F] | KKLFKKILKFL | 11 | Synthetic |
| DCTPep00485 | Dermaseptin S4 [M4D][N20D] | ALWDTLLKKVLKAAAKAALDAVLVGANA | 28 | Synthetic |
| DCTPep00486 | Dermaseptin S4 (1-16)[M4K] | ALWKTLLKKVLKAAAK | 16 | Synthetic |
| DCTPep00487 | Dermaseptin S4 [M4K][N20K] | ALWKTLLKKVLKAAAKAALKAVLVGANA | 28 | Synthetic |
| DCTPep00488 | Dermaseptin S4 [M4K] | ALWKTLLKKVLKAAAKAALNAVLVGANA | 28 | Synthetic |
| DCTPep00489 | Dermaseptin S4 (5-28) | TLLKKVLKAAAKAALNAVLVGANA | 24 | Synthetic |
| DCTPep00490 | cyclosaplin | RLGDGCTR | 8 | somatic seedlings of sandalwood |
| DCTPep00491 | Trichoplaxin | FFGRLKSVWSAVKHGWKAAKSR | 22 | Trichoplax adhaerens |
| DCTPep00492 | APTSTAT3-9R | HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR | 40 | Synthetic |
| DCTPep00494 | LL 37 | [LL-37, 37 aa] | 37 | Also known human cathelicidin |
| DCTPep00495 | Cathelicidin-RC1 | KKCKFFCKVKKKIKSIGFQIPIVSIPFK | 28 | Lithobates catesbeiana |
| DCTPep00496 | LTX-328 | KAQXQKQAW | 9 | Synthetic |
| DCTPep00497 | Chrysophsin-1 | FFGWLIKGAIHAGKAIHGLIHRRRH | 25 | Red sea bream |
| DCTPep00498 | T Peptide | TKPRKTKPRKTKPRKTKPR | 19 | Tuftsin derivative |
| DCTPep00499 | mt_T18S/L22 W/P27A | ESFSDWWKLLAE | 12 | MDM2 |
| DCTPep00500 | mt_S20A/L22 W/P27A | ETFADWWKLLAE | 12 | MDM2 |
| DCTPep00501 | mt_L22 W/P27A | ETFSDWWKLLAE | 12 | MDM2 |
| DCTPep00502 | mt_E17L/L22 W/P27A | LTFSDWWKLLAE | 12 | MDM2 |
This work is licensed under a Creative Commons Attribution 4.0 International License.