This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00153 | Lactoferricin B | FKCRRWQWRMKKLGAPSITCVRRAF | 25 | The big centipede Scolopendra subspinipes mutilans |
| DCTPep00154 | LL-37(17-32)b | FKRIVQRIKDFLRNLV | 16 | LL-37,a series of peptide fragments |
| DCTPep00155 | LL-37(17-29) | FKRIVQRIKDFLR | 13 | LL-37,a series of peptide fragments |
| DCTPep00156 | LL-37(13-37) | IGKEFKRIVQRIKDFLRNLVPRTES | 25 | LL-37,a series of peptide fragments |
| DCTPep00157 | D-K6L9 | LKlLKKLlkKLLkLL | 15 | Host Defense lytic Peptide |
| DCTPep00158 | OGF, 7 | YGGFM | 5 | The native opioid growth factor |
| DCTPep00159 | 8 | YX | 2 | Synthetic |
| DCTPep00160 | 9 | YX | 2 | Synthetic |
| DCTPep00161 | 10 | YX | 2 | Synthetic |
| DCTPep00162 | 15 | YXG | 3 | Synthetic |
| DCTPep00163 | 16 | YXG | 3 | Synthetic |
| DCTPep00164 | 17 | YXGFM | 5 | Synthetic |
| DCTPep00165 | 18 | YXGFM | 5 | Synthetic |
| DCTPep00166 | 23 | YGGFMX | 6 | Synthetic |
| DCTPep00167 | Gaegurin-5 | FLGALFKVASKVLPSVKCAITKKC | 24 | Rana rugosa |
| DCTPep00168 | Gaegurin 5 (1-11)[V8W] | FLGALFKWASK | 11 | Synthetic |
| DCTPep00169 | Gaegurin 5 (1-11)[A4W] | FLGWLFKVASK | 11 | Synthetic |
| DCTPep00170 | Brevinin-Alb | FLPLAVSLAANFLPKLFCKITKKC | 24 | Amolops loloensis; Amolops jingdongensis |
| DCTPep00171 | Cytotoxin drCT-1 (drCT-I) | LKCNKLVPLFYKTCPAGKNL | 20 | Daboia russelii (Russel's viper) (Vipera russelii) |
| DCTPep00175 | Z44 | ALSKALSKALSKALSKALSKALSK | 24 | Xenopus laevis |
| DCTPep00176 | Z24 | AKSKAKSKAKSKAKSKAKSKAKSK | 24 | Xenopus laevis |
| DCTPep00177 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | 23 | Xenopus laevis |
| DCTPep00178 | Odorranain-C1 | GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC | 33 | Odorrana grahami |
| DCTPep00179 | NK23c | KILRGVSKKIMRTFLRRILTGKK | 23 | Synthetic |
| DCTPep00180 | C7S/NK27 | KILRGVSKKIMRTFLRRISKDILTGKK | 27 | Synthetic |
| DCTPep00181 | C7S/NK27-COOH | KILRGVSKKIMRTFLRRISKDILTGKK | 27 | Synthetic |
| DCTPep00182 | NK23a | KISKKIMRTFLRRISKDILTGKK | 23 | Synthetic |
| DCTPep00183 | Gramicidin S | VXLfPVXLfP | 10 | Bacillus brevis |
| DCTPep00184 | Propeptide 5 | fCYwOXXTKKrPKPfQwFwLXKKLMYPTYLKKfQWAVXHL | 40 | Synthetic |
| DCTPep00185 | Dermaseptin-L1 | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 32 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
This work is licensed under a Creative Commons Attribution 4.0 International License.