This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00194 | Pep1 | FKCRRWQWRMKKLGAPSITCVR | 22 | Bovine lactoferrin (Lf-B) |
| DCTPep00195 | mPep1 | RKAFRWAWRMLKKAAPSITCVR | 22 | Bovine lactoferrin (Lf-B) |
| DCTPep00196 | Brevinin-2R | KLKNFAIGVAQSLLNKASCKLSGQC | 25 | Pelophylax ridibundus (Marsh frog) (Rana ridibunda) |
| DCTPep00197 | Buforin IIb | RAGLQFPVGRLLRRLLRRLLR | 21 | Histone H2A |
| DCTPep00200 | PST13-RK | KKKFPWWWPFKKK | 13 | Derivative of tritrpticin |
| DCTPep00201 | di-PST13-RK-C | KKKFPWWWPFKKKCKKKFPWWWPFKKKC | 28 | Derivative of tritrpticin |
| DCTPep00218 | LfcinB | FKCRRWQWRMKK | 12 | Bovine lactoferrin (Lf-B) |
| DCTPep00219 | KW5 | KAAKKAAKAAKKAAKAAKKAA | 21 | Bovine lactoferrin (Lf-B) |
| DCTPep00231 | Camel | KWKLFKKIGAVLKVL | 15 | Ceropin-Melittin hybrid |
| DCTPep00232 | Ceropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | 63 | Musca domestica |
| DCTPep00262 | Buforin II | TRSSRAGLQFPVGRVHRLLRK | 21 | Bufo Bufo Gargarizans |
| DCTPep00264 | Demegen P-113 | AKRHHGYKRKFH | 12 | Amphibian skin peptide |
| DCTPep00265 | OmigaNAn MBI-226 | ILRWPWWPWRRK | 12 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00266 | Pexiganan MSI-78 | GIGKFLKKAKKFGKAFVKILKK | 22 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00267 | Protegrin 1 | RGGRLCYCRRRFCVCVGR | 18 | Alpha helical peptide without cysteines |
| DCTPep00268 | Temporin A | FLPLIGRVLSGIL | 13 | Frog Rana temporaria |
| DCTPep00281 | LTX-302 | WKKWXKKWK | 9 | Synthetic |
| DCTPep00282 | LTX-315 | KKWWKKWXK | 9 | Synthetic |
| DCTPep00283 | LTX-318 | XXWXXXWWX | 9 | Synthetic |
| DCTPep00319 | Cationic Amphiphilic | GIIKKIIIKKI | 11 | AMP |
| DCTPep00320 | Cationic Amphiphilic | GIIKKIIIKKIIIKKI | 16 | AMP |
| DCTPep00321 | Cationic Amphiphilic | GIIKKIIIKKIIIKKIIIKKI | 21 | AMP |
| DCTPep00323 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | 25 | Pleurocidin-family |
| DCTPep00340 | MAC1/2 | AFGMALKLLKKVL | 13 | Synthetic |
| DCTPep00341 | MAC1/26 | GFGMAXKLLKKVL | 13 | Synthetic |
| DCTPep00342 | MAC1/25 | GFGMALKXLKKVL | 13 | Synthetic |
| DCTPep00343 | MAC1/24 | GFGMALKLXKKVL | 13 | Synthetic |
| DCTPep00344 | MAC1 | GFGMALKLLKKVL | 13 | Macropins and their analogs |
| DCTPep00345 | MAC1/1 | gfgmalkllkkvl | 13 | Synthetic |
| DCTPep00346 | MAC1/16 | GFGMALKLlKKVL | 13 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.