This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00048 | Temporin-1Tl | FVQWFSKFLGRIL | 13 | Rana temporaria |
| DCTPep00077 | Citropin 1.1 | GLFDVIKKVASVIGGL | 16 | Amphibian skin secretions |
| DCTPep00096 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | 23 | African clawed frog Xenopus laevis skin |
| DCTPep00097 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | 23 | African clawed frog Xenopus laevis skin |
| DCTPep00147 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | 27 | Sus scrofa (Pig) |
| DCTPep00171 | Cytotoxin drCT-1 (drCT-I) | LKCNKLVPLFYKTCPAGKNL | 20 | Daboia russelii (Russel's viper) (Vipera russelii) |
| DCTPep00172 | Magainin B | GIGKFLHAAKKFAKAFVAEIMNS | 23 | Xenopus laevis |
| DCTPep00175 | Z44 | ALSKALSKALSKALSKALSKALSK | 24 | Xenopus laevis |
| DCTPep00176 | Z24 | AKSKAKSKAKSKAKSKAKSKAKSK | 24 | Xenopus laevis |
| DCTPep00177 | Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS | 23 | Xenopus laevis |
| DCTPep00188 | vibi G | GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN | 31 | V. biflora |
| DCTPep00189 | vibi H | GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN | 31 | V. biflora |
| DCTPep00190 | vibi E | GIPCAESCVWIPCTVTALIGCGCSNKVCYN | 30 | V. biflora |
| DCTPep00191 | vibi D | GLPVCGETCFGGRCNTPGCTCSYPICTRN | 29 | V. biflora |
| DCTPep00236 | Psyle A | GIACGESCVFLGCFIPGCSCKSKVCYFN | 28 | Micronesian Plant Psychotria leptothyrsa |
| DCTPep00237 | Psyle E | GVIPCGESCVFIPCISSVLGCSCKNKVCYRD | 31 | Micronesian Plant Psychotria leptothyrsa |
| DCTPep00238 | Psyle C | KLCGETCFKFKCYTPGCSCSYPFCK | 25 | Micronesian Plant Psychotria leptothyrsa |
| DCTPep00262 | Buforin II | TRSSRAGLQFPVGRVHRLLRK | 21 | Bufo Bufo Gargarizans |
| DCTPep00264 | Demegen P-113 | AKRHHGYKRKFH | 12 | Amphibian skin peptide |
| DCTPep00265 | OmigaNAn MBI-226 | ILRWPWWPWRRK | 12 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00266 | Pexiganan MSI-78 | GIGKFLKKAKKFGKAFVKILKK | 22 | Helical peptide with a predominance of one or more amino acids tryptophane-rich |
| DCTPep00267 | Protegrin 1 | RGGRLCYCRRRFCVCVGR | 18 | Alpha helical peptide without cysteines |
| DCTPep00268 | Temporin A | FLPLIGRVLSGIL | 13 | Frog Rana temporaria |
| DCTPep00279 | Vaby A(1) | GLPVCGETCAGGTCNTPGCSCSWPICTRN | 29 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00280 | Vaby D(4) | GLPVCGETCFGGTCNTPGCTCDPWPVCTRN | 30 | Viola abyssinica of the Ethiopian Highlands |
| DCTPep00412 | N29D | PDEDAINDALNKVCSTGRRQRSICKQLLKK | 30 | Synthetic |
| DCTPep00413 | N29N | PDEDAINNALNKVCSTGRRQRSICKQLLKK | 30 | Synthetic |
| DCTPep00581 | Ctn[1-14] | KRFKKFFKKVKKSV | 14 | Rattlesnake Venom Cathelicidin |
| DCTPep00582 | Ctn(Crotalicidin) | KRFKKFFKKVKKSVKKRLKK工FKKPMVIGVTIPF | 34 | Rattlesnake Venom Cathelicidin |
| DCTPep00605 | NaD1 (1-7)-NaD2 (8-13)-NaD1 (14-47) | RECKTESHRFKGPCITKPPCRKACISEKFTDGHCSKILRRCLCTKPC | 47 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.