This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00450 | Cupiennin-1a | GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME | 35 | Cupiennius salei |
| DCTPep00451 | Caseinphosphopeptides | PPPEE | 5 | Bovine milk |
| DCTPep00452 | αs1-casein f(90_95) | RYLGYL | 6 | Bovine milk |
| DCTPep00453 | β-Casomorphins 5 f(60_64) | YPFPG | 5 | Bovine milk |
| DCTPep00454 | Epinecidin-8 | FIFHIIKGLFHAGKMI | 16 | Epinephelus nebulosus |
| DCTPep00455 | Pardaxin-6 | GFFALIPKIISSPLFKTLLSAVGSALS | 27 | Epinephelus nebulosus |
| DCTPep00457 | Epinecidin-1 | GFIFHIIKGLFHAGKMIHGLV | 21 | Epinephelus nebulosus |
| DCTPep00464 | Sungsanpin | GFGSKPIDSFGLSWL | 15 | Streptomyces |
| DCTPep00466 | TsAP-2 (T. serrulatus antimicrobial peptide 2) | FLGMIPGLIGGLISAFK | 17 | Tityus serrulatus (Brazilian yellow scorpion) |
| DCTPep00467 | TsAP-1 (T. serrulatus antimicrobial peptide 1) | FLSLIPSLVGGSISAFK | 17 | Tityus serrulatus (Brazilian yellow scorpion) |
| DCTPep00468 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | 26 | Apis mellifera (Honeybee) |
| DCTPep00476 | Drosocin-1 | GKPRPYSPRPTSHPRPIRV | 19 | Drosophila melanogaster; Drosophila simulans |
| DCTPep00490 | cyclosaplin | RLGDGCTR | 8 | somatic seedlings of sandalwood |
| DCTPep00491 | Trichoplaxin | FFGRLKSVWSAVKHGWKAAKSR | 22 | Trichoplax adhaerens |
| DCTPep00495 | Cathelicidin-RC1 | KKCKFFCKVKKKIKSIGFQIPIVSIPFK | 28 | Lithobates catesbeiana |
| DCTPep00497 | Chrysophsin-1 | FFGWLIKGAIHAGKAIHGLIHRRRH | 25 | Red sea bream |
| DCTPep00503 | Latarcin-1 | SMWSGMWRRKLKKLRNALKKKLKGE | 25 | Lachesana tarabaevi |
| DCTPep00507 | Toxin F-VIII | MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE | 60 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DCTPep00508 | Toxin C13S1C1 | RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN | 59 | venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae) |
| DCTPep00511 | Hymenochirin-1Pa | LKLSPKTKDTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00512 | [D9K]Hymenochirin-1Pa | LKLSPKTKKTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00513 | [D9k]Hymenochirin-1Pa | LKLSPKTKkTLKKVLKGAIKGAIAIASMA | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00514 | Mastoparan | INLKALAALAKKIL | 14 | Vespula lewisii |
| DCTPep00515 | Ps-2Pa | GIFPIFAKLLGKVIKVASSLISKGRTE | 27 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00516 | Ps-1Pb | IKIPSFFRNILKKVGKEAVSLIAGALKQS | 29 | skin secretions of the frog Pseudhymenochirus merlini (Pipidae) |
| DCTPep00549 | DC1 | GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD | 32 | Hedyotis diffusa |
| DCTPep00550 | DC2 | GAVPCGETCVYLPCITPDIGCSCQNKVCYRD | 31 | Hedyotis diffusa |
| DCTPep00551 | DC3 | GTSCGETCVLLPCLSSVLGCTCQNKRCYKD | 30 | Hedyotis diffusa |
| DCTPep00558 | Callyaerin C | HXLLPPVXPLFG | 12 | Callyspongia aerizusa |
| DCTPep00559 | Callyaerin B | IXIILPPLXPII | 12 | Callyspongia aerizusa |
This work is licensed under a Creative Commons Attribution 4.0 International License.