This work is licensed under a Creative Commons Attribution 4.0 International License.
| DCTPep ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DCTPep00001 | SMAP-29 | RGLRRLGRKIAHGVKKYGPTVLRIIRIA | 28 | Ovis aries |
| DCTPep00012 | CRAMP | ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE | 38 | Mus musculus |
| DCTPep00013 | Hepcidin-25 | DTHFPICIFCCGCCHRSKCGMCCKT | 25 | Homo sapiens; Pan troglodytes; Pongo pygmaeus; Gorilla gorilla; Nomascus concolor; Hylobates lar |
| DCTPep00014 | Hepcidin-20 | ICIFCCGCCHRSKCGMCCKT | 20 | Homo sapiens; Pan troglodytes; Pongo pygmaeus; Gorilla gorilla; Nomascus concolor; Hylobates lar |
| DCTPep00020 | ovispirin-1 | KNLRRIIRKIIHIIKKYG | 18 | Synthetic |
| DCTPep00048 | Temporin-1Tl | FVQWFSKFLGRIL | 13 | Rana temporaria |
| DCTPep00095 | MRP | AIGSILGALAKGLPTLISWIKNR | 23 | Rana tagoi |
| DCTPep00096 | Magainin A | AIGKFLHSAKKFGKAFVGEIMNS | 23 | African clawed frog Xenopus laevis skin |
| DCTPep00097 | Magainin G | GIGKFLHSAKKFAKAFVAEIMNS | 23 | African clawed frog Xenopus laevis skin |
| DCTPep00106 | Gymnin | KTCENLADDY | 10 | Gymnocladus chinensis |
| DCTPep00109 | P. sajor-caju Rnase | DNGEAGRAAR | 10 | Pleurotus sajor-caju |
| DCTPep00121 | Coccinin | KQTENLADTY | 10 | Phaseolus coccineus |
| DCTPep00122 | Agrocybin | ANDPQCLYGNVAAKF | 15 | Agrocybe cylindracea |
| DCTPep00134 | Laxaphycin B | AXQNXXXPLXXVX | 13 | Terrestrial blue-green alga Anabaena laxa or the marine cyanobacterium Lyngbya Majuscula |
| DCTPep00135 | Laxaphycin A | XXXFLXXLGXX | 11 | Terrestrial blue-green alga Anabaena laxa or the marine cyanobacterium Lyngbya Majuscula |
| DCTPep00143 | Antifungal lectin PVAP | SNDIYFNFQR | 10 | Phaseolus vulgaris |
| DCTPep00146 | MPI | IDWKKLLDAAKQIL | 14 | Polybia paulista |
| DCTPep00149 | Brevinin-1DYb | FLSLALAALPKLFCLIFKKC | 20 | Rana dybowskii; Rana pirica; Rana amurensis |
| DCTPep00169 | Gaegurin 5 (1-11)[A4W] | FLGWLFKVASK | 11 | Synthetic |
| DCTPep00170 | Brevinin-Alb | FLPLAVSLAANFLPKLFCKITKKC | 24 | Amolops loloensis; Amolops jingdongensis |
| DCTPep00178 | Odorranain-C1 | GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC | 33 | Odorrana grahami |
| DCTPep00183 | Gramicidin S | VXLfPVXLfP | 10 | Bacillus brevis |
| DCTPep00185 | Dermaseptin-L1 | GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS | 32 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DCTPep00186 | Phylloseptin-L1 | LLGMIPLAISAISALSKL | 18 | skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae) |
| DCTPep00187 | Arenicin-1 | RWCVYAYVRVRGVLVRYRRCW | 21 | Arenicola marina |
| DCTPep00221 | Ltc-5 [M6R] | GFFGKRKEYFKKFGASFKRRFANLKKRL | 28 | Synthetic |
| DCTPep00222 | Ltc-2a (4-26) | GKLIKKFGRKAISYAVKKARGKH | 23 | Synthetic |
| DCTPep00223 | Ltc-5 (4-28) | GKMKEYFKKFGASFKRRFANLKKRL | 25 | Synthetic |
| DCTPep00224 | Ltc-2a [G11L] | GLFGKLIKKFLRKAISYAVKKARGKH | 26 | Synthetic |
| DCTPep00225 | Ltc-2a [F10K] | GLFGKLIKKKGRKAISYAVKKARGKH | 26 | Synthetic |
This work is licensed under a Creative Commons Attribution 4.0 International License.